- Recombinant Aquifex aeolicus Uncharacterized protein aq_1188 (aq_1188)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1044981
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 17,855 Da
- E Coli or Yeast
- 1-155
- Uncharacterized protein aq_1188 (aq_1188)
Sequence
MTFLFLILVFIIEILQLSVFPPIFGNAYIVPSLAFLLVLFSSYKIKEKALLLAFLSGLFYDAVVNFLGFISLLNVVFTYLYLVLNNILFVKNPKVEVFLIMPLILLLRKLTIFLVVNTKFPLNIGLKDFGVVLLIDLIFLILLYKVFNKYVYEKA